Description
GLP-2 (Glucagon-Like Peptide-2) – Research Peptide
Description:
GLP-2 (Glucagon-Like Peptide-2) is a 33-amino acid peptide derived from proglucagon. It is primarily expressed in the intestinal endocrine cells and has been shown in research models to regulate intestinal growth, enhance mucosal integrity, and modulate digestive function.
In experimental settings, GLP-2 is studied for its ability to influence gastrointestinal tissues, particularly its role in promoting epithelial cell proliferation and reducing intestinal permeability. It is also used to explore signaling pathways related to gut function and nutrient transport.
Molecular Formula: C₁₆₆H₂₅₁N₄₇O₅₁
Molecular Weight: 3751.99 g/mol
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Research Applications:
-
Investigation of intestinal epithelial dynamics
-
Studies on gastrointestinal barrier function
-
Exploration of nutrient transport mechanisms
-
Research into gut-associated signaling pathways
